PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK19059.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 164aa    MW: 18469.5 Da    PI: 9.717
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK19059.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.19.9e-55211491128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kge 98 
                lppGfrFhPtdeelvv+yLk+k+++ +l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++s+   +e
  PK19059.1  21 LPPGFRFHPTDEELVVHYLKRKAASAPLPV-TIIAEIDLYKFDPWELPSKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPIMSSngCHE 119
                79****************************.89***************988899****************************************977778 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +vg+kk Lvfy g+ pkg+kt+W+mheyrl
  PK19059.1 120 KVGVKKALVFYGGKPPKGVKTNWIMHEYRL 149
                8***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-6116155IPR003441NAC domain
PROSITE profilePS5100556.88421164IPR003441NAC domain
PfamPF023654.1E-2922149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MENSTDSSSS LRSSQEQHPK LPPGFRFHPT DEELVVHYLK RKAASAPLPV TIIAEIDLYK  60
FDPWELPSKA SFGEQEWYFF SPRDRKYPNG ARPNRAATSG YWKATGTDKP IMSSNGCHEK  120
VGVKKALVFY GGKPPKGVKT NWIMHEYRLV DSSSSSSTNI NNIX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-692116217156NAC domain-containing protein 19
4dul_A1e-692116217156NAC domain-containing protein 19
1ut7_B1e-692116217156NO APICAL MERISTEM PROTEIN
1ut7_A1e-692116217156NO APICAL MERISTEM PROTEIN
1ut4_B1e-692116217156NO APICAL MERISTEM PROTEIN
1ut4_A1e-692116217156NO APICAL MERISTEM PROTEIN
3swp_D1e-692116220159NAC domain-containing protein 19
3swp_C1e-692116220159NAC domain-containing protein 19
3swp_B1e-692116220159NAC domain-containing protein 19
3swp_A1e-692116220159NAC domain-containing protein 19
3swm_D1e-692116220159NAC domain-containing protein 19
3swm_C1e-692116220159NAC domain-containing protein 19
3swm_B1e-692116220159NAC domain-containing protein 19
3swm_A1e-692116220159NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015888238.14e-95PREDICTED: NAC transcription factor 25-like, partial
RefseqXP_007025712.13e-94NAC domain containing protein 25
SwissprotA2YMR07e-92NAC10_ORYSI; NAC transcription factor ONAC010
TrEMBLA0A061GMK33e-94A0A061GMK3_THECC; NAC domain containing protein 25
TrEMBLD7U6G03e-94D7U6G0_VITVI; Putative uncharacterized protein
STRINGVIT_00s0375g00040.t017e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.14e-85NAC domain containing protein 25